PeptideDB

Angiopep-Bim BH3 hydrochloride

CAS: F: C277H415ClN82O82S W: 6273.28

Angiopep-Bim BH3 hydrochloride, a BBB penetrated peptode, could be used to investigate the permeability of CNS therapeut
Sales Email：peptidedb@qq.com
Contact QiTai

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Angiopep-Bim BH3 hydrochloride, a BBB penetrated peptode, could be used to investigate the permeability of CNS therapeutics[1].
Name Angiopep-Bim BH3 hydrochloride
Shortening TFFYGGSRGKRNNFKTEEYLPSTGGGGGDMRPEIWIAQELRRIGDEFNAYYARR
Formula C277H415ClN82O82S
Molar Mass 6273.28
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

[D-Trp34]-Neuropeptide Y

Autocamtide-2-related inhibitory peptide

Product Recommendation

Latest release

Hot list

Copyright © 2025 PeptideDB All Rights Reserved

Sitemaps | Contact

Is for research use only, not for human use. We do not sell to patients.