| Bioactivity | Abaecin is an antibacterial response peptide. Abaecin shows specific activity against an Apidaecin-resistant Xanthomonas strain[1]. |
| Name | Abaecin |
| CAS | 123997-18-2 |
| Sequence | Tyr-Val-Pro-Leu-Pro-Asn-Val-Pro-Gln-Pro-Gly-Arg-Arg-Pro-Phe-Pro-Thr-Phe-Pro-Gly-Gln-Gly-Pro-Phe-Asn-Pro-Lys-Ile-Lys-Trp-Pro-Gln-Gly-Tyr |
| Shortening | YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY |
| Formula | C187H270N48O43 |
| Molar Mass | 3878.44 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Casteels P, et, al. Isolation and characterization of abaecin, a major antibacterial response peptide in the honeybee (Apis mellifera). Eur J Biochem. 1990 Jan 26;187(2):381-6. |
Abaecin
CAS: 123997-18-2 F: C187H270N48O43 W: 3878.44
Abaecin is an antibacterial response peptide. Abaecin shows specific activity against an Apidaecin-resistant Xanthomonas
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.