| Bioactivity | AaHI is a neurotoxin that can be obtained from the venom of the North African scorpion Androctonus australis hector. AaHI can be used as a tool for the development of active substances with toxin-neutralizing capabilities[1]. |
| Name | AaHI |
| CAS | 820981-26-8 |
| Sequence | Lys-Arg-Asp-Gly-Tyr-Ile-Val-Tyr-Pro-Asn-Asn-Cys-Val-Tyr-His-Cys-Val-Pro-Pro-Cys-Asp-Gly-Leu-Cys-Lys-Lys-Asn-Gly-Gly-Ser-Ser-Gly-Ser-Cys-Ser-Phe-Leu-Val-Pro-Ser-Gly-Leu-Ala-Cys-Trp-Cys-Lys-Asp-Leu-Pro-Asp-Asn-Val-Pro-Ile-Lys-Asp-Thr-Ser-Arg-Lys-Cys-Thr (Disulfide bridge:Cys12-Cys62;Cys16-Cys34;Cys20-Cys44;Cys24-Cys46) |
| Shortening | KRDGYIVYPNNCVYHCVPPCDGLCKKNGGSSGSCSFLVPSGLACWCKDLPDNVPIKDTSRKCT (Disulfide bridge:Cys12-Cys62;Cys16-Cys34;Cys20-Cys44;Cys24-Cys46) |
| Formula | C293H452N82O89S8 |
| Molar Mass | 6803.80 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Devaux C, et al. Construction and functional evaluation of a single-chain antibody fragment that neutralizes toxin AahI from the venom of the scorpion Androctonus australis hector. Eur J Biochem. 2001 Feb;268(3):694-702. |
AaHI
CAS: 820981-26-8 F: C293H452N82O89S8 W: 6803.80
AaHI is a neurotoxin that can be obtained from the venom of the North African scorpion Androctonus australis hector. AaH
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.