PeptideDB

ANK peptide

CAS: 929207-58-9 F: C152H244N52O46S2 W: 3600.01

ANK peptide is a novel peptide designed based on the conserved residues of single ankyrin motif. ANK peptide is a synucl
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity ANK peptide is a novel peptide designed based on the conserved residues of single ankyrin motif. ANK peptide is a synuclein-γ (SNCG) inhibitor that binds to SNCG and competes with SNCG-BubR1 interaction to enhance the sensitivity of breast cancer cells to antimicrotubule drugs such as nocodazole and paclitaxel. ANK peptide can be used in the study of cancer[1].
CAS 929207-58-9
Sequence Lys-Gly-Asn-Ser-Ala-Leu-His-Val-Ala-Ser-Gln-His-Gly-His-Leu-Gly-Cys-Ile-Gln-Thr-Leu-Val-Arg-Tyr-Gly-Ala-Asn-Val-Thr-Met-Gln-Asn-His-Gly
Shortening KGNSALHVASQHGHLGCIQTLVRYGANVTMQNHG
Formula C152H244N52O46S2
Molar Mass 3600.01
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Singh VK, et al. Synuclein-gamma targeting peptide inhibitor that enhances sensitivity of breast cancer cells to antimicrotubule drugs. Cancer Res. 2007 Jan 15;67(2):626-33.