| Bioactivity | ANK peptide is a novel peptide designed based on the conserved residues of single ankyrin motif. ANK peptide is a synuclein-γ (SNCG) inhibitor that binds to SNCG and competes with SNCG-BubR1 interaction to enhance the sensitivity of breast cancer cells to antimicrotubule drugs such as nocodazole and paclitaxel. ANK peptide can be used in the study of cancer[1]. |
| CAS | 929207-58-9 |
| Sequence | Lys-Gly-Asn-Ser-Ala-Leu-His-Val-Ala-Ser-Gln-His-Gly-His-Leu-Gly-Cys-Ile-Gln-Thr-Leu-Val-Arg-Tyr-Gly-Ala-Asn-Val-Thr-Met-Gln-Asn-His-Gly |
| Shortening | KGNSALHVASQHGHLGCIQTLVRYGANVTMQNHG |
| Formula | C152H244N52O46S2 |
| Molar Mass | 3600.01 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Singh VK, et al. Synuclein-gamma targeting peptide inhibitor that enhances sensitivity of breast cancer cells to antimicrotubule drugs. Cancer Res. 2007 Jan 15;67(2):626-33. |