| Bioactivity | ACV1 (Vc1.1), an α-Conotoxin, is a selective α9α10 nAChR antagonist with an IC50 of 19 nM. ACV1 is ~100-fold less potent on human α9α10 vs. rat nAChRs[1]. |
| Target | IC50: 19 nM (α9α10 nAChR), 140 nM (α6/α3β2β3), 980 nM (α6/α3β4) |
| Name | ACV1 |
| CAS | 740980-24-9 |
| Sequence | Met-Gly-Met-Arg-Met-Met-Phe-Thr-Val-Phe-Leu-Leu-Val-Val-Leu-Ala-Thr-Thr-Val-Val-Ser-Ser-Thr-Ser-Gly-Arg-Arg-Glu-Phe-Arg-Gly-Arg-Asn-Ala-Ala-Ala-Lys-Ala-Ser-Asp-Leu-Val-Ser-Leu-Thr-Asp-Lys-Lys-Arg-Gly-Cys-Cys-Ser-Asp-Pro-Arg-Cys-Asn-Tyr-Asp-His-Pro-Glu-Ile-Cys-Gly |
| Shortening | MGMRMMFTVFLLVVLATTVVSSTSGRREFRGRNAAAKASDLVSLTDKKRGCCSDPRCNYDHPEICG |
| Formula | C71H103N23O25S4 |
| Molar Mass | 1806.98 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. J Michael McIntosh, et al. Alpha9 nicotinic acetylcholine receptors and the treatment of pain. Biochem Pharmacol. 2009 Oct 1;78(7):693-702. |