PeptideDB

(Met(O)35)-Amyloid β-Protein (1-42)

CAS: F: C203H311N55O61S W: 4530.04

(Met(O)35)-Amyloid β-Protein (1-42) is the oxidation form of Met35 in Aβ42. (Met(O)35)-Amyloid β-Protein (1-42) can y
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity (Met(O)35)-Amyloid β-Protein (1-42) is the oxidation form of Met35 in Aβ42. (Met(O)35)-Amyloid β-Protein (1-42) can yield an oligomer size distribution characteristic of Aβ40. (Met(O)35)-Amyloid β-Protein (1-42) can be used in the research of Alzheimer’s disease (AD)[1].
Invitro (Met(O)35)-Amyloid β-Protein (1-42) yields an oligomer size distribution characteristic of Aβ40[1].(Met(O)35)-Amyloid β-Protein (1-42) can form fibrils faster[1]..(Met(O)35)-Amyloid β-Protein (1-42) blocks paranucleus formation and produced oligomers indistinguishable in size and morphology from those produced by Aβ40[1].
Name (Met(O)35)-Amyloid β-Protein (1-42)
Shortening DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-{Met(O)}-VGGVVIA
Formula C203H311N55O61S
Molar Mass 4530.04
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.