| Bioactivity | (Met(O)35)-Amyloid β-Protein (1-42) is the oxidation form of Met35 in Aβ42. (Met(O)35)-Amyloid β-Protein (1-42) can yield an oligomer size distribution characteristic of Aβ40. (Met(O)35)-Amyloid β-Protein (1-42) can be used in the research of Alzheimer’s disease (AD)[1]. |
| Invitro | (Met(O)35)-Amyloid β-Protein (1-42) yields an oligomer size distribution characteristic of Aβ40[1].(Met(O)35)-Amyloid β-Protein (1-42) can form fibrils faster[1]..(Met(O)35)-Amyloid β-Protein (1-42) blocks paranucleus formation and produced oligomers indistinguishable in size and morphology from those produced by Aβ40[1]. |
| Name | (Met(O)35)-Amyloid β-Protein (1-42) |
| Shortening | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-{Met(O)}-VGGVVIA |
| Formula | C203H311N55O61S |
| Molar Mass | 4530.04 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
(Met(O)35)-Amyloid β-Protein (1-42)
CAS: F: C203H311N55O61S W: 4530.04
(Met(O)35)-Amyloid β-Protein (1-42) is the oxidation form of Met35 in Aβ42. (Met(O)35)-Amyloid β-Protein (1-42) can y
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.