| Bioactivity | (Asp28)-Exenatide is a degradation product of exenatide (HY-13443). (Asp28)-Exenatide can be used as a GLP-1R agonist[1]. |
| Target | GLP-1R |
| Name | (Asp28)-Exenatide |
| CAS | 1678417-24-7 |
| Sequence | His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asp-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
| Shortening | HGEGTFTSDLSKQMEEEAVRLFIEWLKDGGPSSGAPPPS-NH2 |
| Formula | C184H281N49O61S |
| Molar Mass | 4187.56 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Schneider EL, et al. A Hydrogel-Microsphere Drug Delivery System That Supports Once-Monthly Administration of a GLP-1 Receptor Agonist. ACS Chem Biol. 2017 Aug 18;12(8):2107-2116. |
(Asp28)-Exenatide
CAS: 1678417-24-7 F: C184H281N49O61S W: 4187.56
(Asp28)-Exenatide is a degradation product of exenatide (HY-13443). (Asp28)-Exenatide can be used as a GLP-1R agonist.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.