| Bioactivity | ω-Grammotoxin SIA (GrTx) is P/Q and N-type voltage-gated Calcium channels inhibitor. ω-Grammotoxin SIA is also a protein toxin that can be obtained from spider venom. ω-Grammotoxin SIA has the potential to study neurological diseases as well as cardiovascular diseases[1]. |
| Name | ω-Grammotoxin SIA |
| CAS | 152617-90-8 |
| Sequence | Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys30) |
| Shortening | DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys30) |
| Formula | C177H263N53O49S6 |
| Molar Mass | 4109.70 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Takeuchi K, et al. Solution structure of omega-grammotoxin SIA, a gating modifier of P/Q and N-type Ca(2+) channel. J Mol Biol. 2002 Aug 16;321(3):517-26. |