PeptideDB

ω-Grammotoxin SIA

CAS: 152617-90-8 F: C177H263N53O49S6 W: 4109.70

ω-Grammotoxin SIA (GrTx) is P/Q and N-type voltage-gated Calcium channels inhibitor. ω-Grammotoxin SIA is also a prote
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity ω-Grammotoxin SIA (GrTx) is P/Q and N-type voltage-gated Calcium channels inhibitor. ω-Grammotoxin SIA is also a protein toxin that can be obtained from spider venom. ω-Grammotoxin SIA has the potential to study neurological diseases as well as cardiovascular diseases[1].
Name ω-Grammotoxin SIA
CAS 152617-90-8
Sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys30)
Shortening DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys30)
Formula C177H263N53O49S6
Molar Mass 4109.70
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Takeuchi K, et al. Solution structure of omega-grammotoxin SIA, a gating modifier of P/Q and N-type Ca(2+) channel. J Mol Biol. 2002 Aug 16;321(3):517-26.