| Bioactivity | ω-Agatoxin IVA is a potent, selective P/Q type Ca2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca2+ channels, respectively. ω-Agatoxin IVA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA has no effect on L-type or N-type calcium channels[1][2]. |
| Name | ω-Agatoxin IVA |
| CAS | 145017-83-0 |
| Sequence | Lys-Lys-Lys-Cys-Ile-Ala-Lys-Asp-Tyr-Gly-Arg-Cys-Lys-Trp-Gly-Gly-Thr-Pro-Cys-Cys-Arg-Gly-Arg-Gly-Cys-Ile-Cys-Ser-Ile-Met-Gly-Thr-Asn-Cys-Glu-Cys-Lys-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Gly-Leu-Ala (Disulfide bridge:Cys4-Cys20,Cys12-Cys25,Cys19-Cys36,Cys27-Cys34) |
| Shortening | KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA (Disulfide bridge:Cys4-Cys20,Cys12-Cys25,Cys19-Cys36,Cys27-Cys34) |
| Formula | C217H360N68O60S10 |
| Molar Mass | 5202.25 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
ω-Agatoxin IVA
CAS: 145017-83-0 F: C217H360N68O60S10 W: 5202.25
ω-Agatoxin IVA is a potent, selective P/Q type Ca2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type an
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.