| Bioactivity | π-TRTX-Hm3a is a 37-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. π-TRTX-Hm3a pH-dependently inhibits acid-sensing ion channel 1a (ASIC1a) with an IC50 of 1-2 nM and potentiates ASIC1b with an EC50 of 46.5 nM[1]. |
| Name | π-TRTX-Hm3a |
| Sequence | Glu-Pro-Cys-Ile-Pro-Lys-Trp-Lys-Ser-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Ala-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Lys-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Val (Disulfide bridge:Cys3-Cys18;Cys10-Cys23;Cys17-Cys33) |
| Shortening | EPCIPKWKSCVNRHGDCCAGLECWKRRKSFEVCVPKV (Disulfide bridge:Cys3-Cys18;Cys10-Cys23;Cys17-Cys33) |
| Formula | C186H290N56O49S6 |
| Molar Mass | 4287.03 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Sing Yan Er, et al. Discovery and molecular interaction studies of a highly stable, tarantula peptide modulator of acid-sensing ion channel 1. Neuropharmacology. 2017 Dec:127:185-195. |