| Bioactivity | μ-TRTX-Hd1a, a spider venom, is a selective NaV 1.7 inhibitor. μ-TRTX-Hd1a is a gating modifier that inhibits human NaV 1.7 by interacting with the S3b-S4 paddle motif in channel domain II[1]. |
| Name | μ-TRTX-Hd1a |
| Sequence | Ala-Cys-Leu-Gly-Phe-Gly-Lys-Ser-Cys-Asn-Pro-Ser-Asn-Asp-Gln-Cys-Cys-Lys-Ser-Ser-Ser-Leu-Ala-Cys-Ser-Thr-Lys-His-Lys-Trp-Cys-Lys-Tyr-Glu-Leu (Disulfide bridge:Cys2-Cys17;Cys9-Cys24;Cys16-Cys31) |
| Shortening | ACLGFGKSCNPSNDQCCKSSSLACSTKHKWCKYEL (Disulfide bridge:Cys2-Cys17;Cys9-Cys24;Cys16-Cys31) |
| Formula | C160H246N46O51S6 |
| Molar Mass | 3822.33 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Julie K Klint, et al. Seven novel modulators of the analgesic target NaV 1.7 uncovered using a high-throughput venom-based discovery approach. Br J Pharmacol. 2015 May;172(10):2445-58. |