PeptideDB

κ-Bungarotoxin

CAS: 124511-67-7 F: C303H475N91O97S10 W: 7265.22

κ-Bungarotoxin (κ-Bgt) is a potent, selective, and slowly reversible antagonist of α3β2 neuronal nicotinic acetylcho
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity κ-Bungarotoxin (κ-Bgt) is a potent, selective, and slowly reversible antagonist of α3β2 neuronal nicotinic acetylcholine receptors with an IC50 of 2.30 nM[1].
Target IC50: 2.30 nM (recombinantly expressed in P. pastoris against α3β2)
Name κ-Bungarotoxin
CAS 124511-67-7
Sequence Arg-Thr-Cys-Leu-Ile-Ser-Pro-Ser-Ser-Thr-Pro-Gln-Thr-Cys-Pro-Asn-Gly-Gln-Asp-Ile-Cys-Phe-Leu-Lys-Ala-Gln-Cys-Asp-Lys-Phe-Cys-Ser-Ile-Arg-Gly-Pro-Val-Ile-Glu-Gln-Gly-Cys-Val-Ala-Thr-Cys-Pro-Gln-Phe-Arg-Ser-Asn-Tyr-Arg-Ser-Leu-Leu-Cys-Cys-Thr-Thr-Asp-Asn-Cys-Asn-His (Disulfide bridge:Cys3-Cys21, Cys14-Cys42, Cys27-Cys31, Cys46-Cys58, Cys59-Cys64)
Shortening RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH (Disulfide bridge:Cys3-Cys21, Cys14-Cys42, Cys27-Cys31, Cys46-Cys58, Cys59-Cys64)
Formula C303H475N91O97S10
Molar Mass 7265.22
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Grant GA, et al. Differential roles for disulfide bonds in the structural integrity and biological activity of kappa-Bungarotoxin, a neuronal nicotinic acetylcholine receptor antagonist. Biochemistry. 1998 Sep 1;37(35):12166-71.