Bioactivity | κ-Bungarotoxin (κ-Bgt) is a potent, selective, and slowly reversible antagonist of α3β2 neuronal nicotinic acetylcholine receptors with an IC50 of 2.30 nM[1]. |
Target | IC50: 2.30 nM (recombinantly expressed in P. pastoris against α3β2) |
Name | κ-Bungarotoxin |
CAS | 124511-67-7 |
Sequence | Arg-Thr-Cys-Leu-Ile-Ser-Pro-Ser-Ser-Thr-Pro-Gln-Thr-Cys-Pro-Asn-Gly-Gln-Asp-Ile-Cys-Phe-Leu-Lys-Ala-Gln-Cys-Asp-Lys-Phe-Cys-Ser-Ile-Arg-Gly-Pro-Val-Ile-Glu-Gln-Gly-Cys-Val-Ala-Thr-Cys-Pro-Gln-Phe-Arg-Ser-Asn-Tyr-Arg-Ser-Leu-Leu-Cys-Cys-Thr-Thr-Asp-Asn-Cys-Asn-His (Disulfide bridge:Cys3-Cys21, Cys14-Cys42, Cys27-Cys31, Cys46-Cys58, Cys59-Cys64) |
Shortening | RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH (Disulfide bridge:Cys3-Cys21, Cys14-Cys42, Cys27-Cys31, Cys46-Cys58, Cys59-Cys64) |
Formula | C303H475N91O97S10 |
Molar Mass | 7265.22 |
Transport | Room temperature in continental US; may vary elsewhere. |
Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Reference | [1]. Grant GA, et al. Differential roles for disulfide bonds in the structural integrity and biological activity of kappa-Bungarotoxin, a neuronal nicotinic acetylcholine receptor antagonist. Biochemistry. 1998 Sep 1;37(35):12166-71. |