| Bioactivity | δ-Dendrotoxin is a K+ channel blocker that can be obtained from the venom of the black mamba snake. δ-Dendrotoxin can be used in the study of neurological diseases[1]. |
| Name | δ-Dendrotoxin |
| CAS | 189201-23-8 |
| Sequence | Ala-Ala-Lys-Tyr-Cys-Lys-Leu-Pro-Val-Arg-Tyr-Gly-Pro-Cys-Lys-Lys-Lys-Ile-Pro-Ser-Phe-Tyr-Tyr-Lys-Trp-Lys-Ala-Lys-Gln-Cys-Leu-Pro-Phe-Asp-Tyr-Ser-Gly-Cys-Gly-Gly-Asn-Ala-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Val-Gly (Disulfide bridge:Cys5-Cys55, Cys14-Cys38, Cys30-Cys51) |
| Shortening | AAKYCKLPVRYGPCKKKIPSFYYKWKAKQCLPFDYSGCGGNANRFKTIEECRRTCVG (Disulfide bridge:Cys5-Cys55, Cys14-Cys38, Cys30-Cys51) |
| Formula | C296H452N82O76S6 |
| Molar Mass | 6567.65 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Jin L, et al. Molecular mechanism of δ-dendrotoxin-potassium channel recognition explored by docking and molecular dynamic simulations. J Mol Recognit. 2011 Jan-Feb;24(1):101-7. |