PeptideDB

δ-Buthitoxin-Hj2a

CAS: F: C304H458N90O93S8 W: 7117.96

δ-Buthitoxin-Hj2a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 32 nM. δ-Buthitoxin-Hj2a can b
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity δ-Buthitoxin-Hj2a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 32 nM. δ-Buthitoxin-Hj2a can be used for the Dravet syndrome (DS) research[1].
Name δ-Buthitoxin-Hj2a
Sequence Gly-Arg-Asp-Ala-Tyr-Ile-Ala-Asp-Asp-Lys-Asn-Cys-Val-Tyr-Thr-Cys-Ala-Lys-Asn-Ser-Tyr-Cys-Asn-Asn-Glu-Cys-Thr-Lys-Asn-Gly-Ala-Glu-Ser-Gly-Tyr-Cys-Gln-Trp-Leu-Gly-Lys-Tyr-Gly-Asn-Gly-Cys-Trp-Cys-Lys-Asn-Leu-Pro-Asp-Lys-Val-Pro-Ile-Arg-Ile-Pro-Gly-Pro-Cys-Arg-NH2 (Disulfide bridge:(Disulfide bridge:Cys12-Cys63;Cys16-Cys36;Cys22-Cys46;Cys26-Cys48)
Shortening GRDAYIADDKNCVYTCAKNSYCNNECTKNGAESGYCQWLGKYGNGCWCKNLPDKVPIRIPGPCR-NH2 (Disulfide bridge:(Disulfide bridge:Cys12-Cys63;Cys16-Cys36;Cys22-Cys46;Cys26-Cys48)
Formula C304H458N90O93S8
Molar Mass 7117.96
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Chun Yuen Chow, et al. Venom Peptides with Dual Modulatory Activity on the Voltage-Gated Sodium Channel NaV1.1 Provide Novel Leads for Development of Antiepileptic Drugs. ACS Pharmacol Transl Sci. 2019 Nov 25;3(1):119-134.