| Bioactivity | δ-Buthitoxin-Hj1a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 17nM. δ-Buthitoxin-Hj1a can be used for the Dravet syndrome (DS) research[1]. |
| Name | δ-Buthitoxin-Hj1a |
| Sequence | Glu-Glu-Val-Arg-Asp-Ala-Tyr-Ile-Ala-Gln-Pro-His-Asn-Cys-Val-Tyr-His-Cys-Phe-Arg-Asp-Ser-Tyr-Cys-Asn-Asp-Leu-Cys-Ile-Lys-His-Gly-Ala-Glu-Ser-Gly-Glu-Cys-Lys-Trp-Phe-Thr-Ser-Ser-Gly-Asn-Ala-Cys-Trp-Cys-Val-Lys-Leu-Pro-Lys-Ser-Glu-Pro-Ile-Lys-Val-Pro-Gly-Lys-Cys-His (Disulfide bridge:Cys14-Cys65;Cys18-Cys38;Cys24-Cys48;Cys28-Cys50) |
| Shortening | EEVRDAYIAQPHNCVYHCFRDSYCNDLCIKHGAESGECKWFTSSGNACWCVKLPKSEPIKVPGKCH (Disulfide bridge:Cys14-Cys65;Cys18-Cys38;Cys24-Cys48;Cys28-Cys50) |
| Formula | C326H482N92O96S8 |
| Molar Mass | 7482.39 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Chun Yuen Chow, et al. Venom Peptides with Dual Modulatory Activity on the Voltage-Gated Sodium Channel NaV1.1 Provide Novel Leads for Development of Antiepileptic Drugs. ACS Pharmacol Transl Sci. 2019 Nov 25;3(1):119-134. |