| Bioactivity | β-Endorphin, rat (β-Lipotropin 61-91), a neuropeptide, is involved in cardiovascular regulation. β-Endorphin, rat induces marked, prolonged muscular rigidity and immobility similar to a catatonic state in rats[1][2]. |
| Name | β-Endorphin, rat |
| CAS | 59887-17-1 |
| Sequence | Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln |
| Shortening | YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ |
| Formula | C155H250N42O44S |
| Molar Mass | 3437.96 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Bloom F, et al. Endorphins: profound behavioral effects in rats suggest new etiological factors in mental illness. Science. 1976 Nov 5;194(4265):630-2. [2]. Hill C, et al. The effects of beta-endorphin (beta-END) on cardiovascular and behavioral dynamics in conscious rats. Brain Res Bull. 2002 Oct 15;59(1):29-34. |