| Bioactivity | β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity. | ||||||
| Invitro | β-Endorphin, human is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor. β-Endorphin exhibits anti-nociception activity by stimulating ε-opioid receptor, rather than μ-, δ-, and κ-opioid receptor[1]. β-Endorphin has anti-nociception activity. Firstly, β-Endorphin combines together with the opioid receptors in hyperalgesia. Further, β-Endorphin suppresses the release of substance P at the level of spinal cord and blocks the conduction of pain on the primary sensory neurons. Moreover, β-Endorphin activates the endogenous analgesia system located in the CNS. In addition, β-Endorphin inhibits the conduction of pain and agitation of nociceptors to exert an analgesic effect[2]. | ||||||
| Name | β-Endorphin, human | ||||||
| CAS | 61214-51-5 | ||||||
| Sequence | Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu | ||||||
| Shortening | YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE | ||||||
| Formula | C158H251N39O46S | ||||||
| Molar Mass | 3464.98 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
β-Endorphin, human
CAS: 61214-51-5 F: C158H251N39O46S W: 3464.98
β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.