| Bioactivity | β-Endorphin, equine is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors[1][2]. Analgesic properties[2]. |
| Name | β-Endorphin, equine |
| CAS | 79495-86-6 |
| Sequence | Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln |
| Shortening | YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ |
| Formula | C154H248N42O44S |
| Molar Mass | 3423.94 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
β-Endorphin, equine
CAS: 79495-86-6 F: C154H248N42O44S W: 3423.94
β-Endorphin, equine is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. Analg
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.