PeptideDB

β-Amyloid-15N (1-40) (TFA)

CAS: F: C196H296F3N5215NO60S W: 4444.82

β-Amyloid-15N (1-40) (TFA) is the 15N-labledβ-Amyloid (1-40) (TFA). β-Amyloid (1-40) is a primary protein in plaques
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity β-Amyloid-15N (1-40) (TFA) is the 15N-labledβ-Amyloid (1-40) (TFA). β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease[1].
Invitro Stable heavy isotopes of hydrogen, carbon, and other elements have been incorporated into drug molecules, largely as tracers for quantitation during the drug development process. Deuteration has gained attention because of its potential to affect the pharmacokinetic and metabolic profiles of drugs[2].
Name β-Amyloid-15N (1-40) (TFA)
Shortening DA-{Glu-15N}-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (TFA)
Formula C196H296F3N5215NO60S
Molar Mass 4444.82
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.