| Bioactivity | β-Amyloid-15N (1-40) (TFA) is the 15N-labledβ-Amyloid (1-40) (TFA). β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease[1]. |
| Invitro | Stable heavy isotopes of hydrogen, carbon, and other elements have been incorporated into drug molecules, largely as tracers for quantitation during the drug development process. Deuteration has gained attention because of its potential to affect the pharmacokinetic and metabolic profiles of drugs[2]. |
| Name | β-Amyloid-15N (1-40) (TFA) |
| Shortening | DA-{Glu-15N}-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (TFA) |
| Formula | C196H296F3N5215NO60S |
| Molar Mass | 4444.82 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |