| Bioactivity | β-Amyloid (40-1) is a biological active peptide. (non-toxic reverse fragment Aβ(40–1), control of HY-P0265) |
| Name | β-Amyloid (40-1) |
| CAS | 144409-99-4 |
| Sequence | Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp |
| Shortening | VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
| Formula | C194H295N53O58S |
| Molar Mass | 4329.80 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
β-Amyloid (40-1)
CAS: 144409-99-4 F: C194H295N53O58S W: 4329.80
β-Amyloid (40-1) is a biological active peptide. (non-toxic reverse fragment Aβ(40–1), control of HY-P0265)
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.