| Bioactivity | β-Amyloid (1-43)(human) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human) could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use[1]. |
| Name | β-Amyloid (1-43)(human) |
| CAS | 134500-80-4 |
| Sequence | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr |
| Shortening | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT |
| Formula | C207H318N56O62S |
| Molar Mass | 4615.19 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
β-Amyloid (1-43)(human)
CAS: 134500-80-4 F: C207H318N56O62S W: 4615.19
β-Amyloid (1-43)(human) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Am
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.