β-Amyloid (1-40), FAM-labeled_product_DataBase

Bioactivity	β-Amyloid (1-40), FAM-labeled is a FAM fluorescently-labelled β-Amyloid (1-40) peptide (λex= 492 nm and λem= 518 nm)[1].
Invitro	Apical-to-basolateral exchange across endothelial monolayer of fluorescent Aβ42 (FAM-labeled Human β-Amyloid (1-42) and Fluor™488-labeled β-Amyloid (1-42)) or scramble Aβ42 (FAM-labeled scrambled β-Amyloid (1-42)) (1-100 μM) is monitored in transendothelial electrical resistance (TEER) during cell monolayer’s formation over time (over 120 min in presence or absence of Aβ24). Human β-Amyloid (1-24) (1 μM) results in H-Aβ42 retention, thus reducing its efflux through the BBB and therefore preventing an efficient mechanism of Aβ42 clearance[1].The in vitro BBB model is used to investigate the passage of FAM-labeled or 488-conjugated H-Aβ42 across the endothelial cell monolayer. The addition of fluorescently labeled H-Aβ42 (FAM-labeled Human β-Amyloid (1-42) or Fluor™ 488-labeled β-Amyloid (1-42)) to the apical side of cell inserts results in effective BBB crossing, FAM-labeled scrambled β-Amyloid (1-42) is not efficiently transcytosed.
Name	β-Amyloid (1-40), FAM-labeled
CAS	1678416-08-4
Shortening	FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Formula	C215H305N53O64S
Molar Mass	4688.20
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.

PeptideDB