| Bioactivity | β-Amyloid (1-38), mouse, rat is composed of 38 aa (1-38 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease[1]. |
| Name | β-Amyloid (1-38), mouse, rat |
| CAS | 186359-66-0 |
| Shortening | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG |
| Formula | C180H273N49O55S1 |
| Molar Mass | 4035.50 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
β-Amyloid (1-38), mouse, rat
CAS: 186359-66-0 F: C180H273N49O55S1 W: 4035.50
β-Amyloid (1-38), mouse, rat is composed of 38 aa (1-38 residues of the Aβ peptide) and is the primary component of th
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.