| Bioactivity | β-Amyloid (1-37) (human) correlates moderately with Mini-Mental State Examination (MMSE) scores in Alzheimer disease. β-Amyloid (1-37) (human) possesses an added diagnostic value[1]. |
| Invitro | Aβ1-42/Aβ1-40/ as well as Aβ1-42/Aβ1-37 significantly increases the performance of Aβ1-42 alone to discriminate MCI and controls[1]. |
| Name | β-Amyloid (1-37) (human) |
| CAS | 186359-67-1 |
| Sequence | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly |
| Shortening | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG |
| Formula | C182H274N50O55S |
| Molar Mass | 4074.53 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
β-Amyloid (1-37) (human)
CAS: 186359-67-1 F: C182H274N50O55S W: 4074.53
β-Amyloid (1-37) (human) correlates moderately with Mini-Mental State Examination (MMSE) scores in Alzheimer disease.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.