PeptideDB

α-Dendrotoxin

CAS: 74504-53-3 F: C305H478N98O84S6 W: 7072.00

α-Dendrotoxin (α-DTX) is a small molecule peptide neurotoxin isolated from the venom of the African green mamba snake
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity α-Dendrotoxin (α-DTX) is a small molecule peptide neurotoxin isolated from the venom of the African green mamba snake (Dendroaspis angusticeps). α-Dendrotoxin is also a KV1.1, KV1.2, KV1.6 and ASIC channel blocker. α-Dendrotoxin blocks potassium channels, lowers the threshold of neuronal action potentials, and increases the frequency of action potentials, thereby enhancing neuronal excitability. α-Dendrotoxin can be used in neurotoxicology research[1].
CAS 74504-53-3
Sequence {Pyr}-Pro-Arg-Arg-Lys-Leu-Cys-Ile-Leu-His-Arg-Asn-Pro-Gly-Arg-Cys-Tyr-Asp-Lys-Ile-Pro-Ala-Phe-Tyr-Tyr-Asn-Gln-Lys-Lys-Lys-Gln-Cys-Glu-Arg-Phe-Asp-Trp-Ser-Gly-Cys-Gly-Gly-Asn-Ser-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Ile-Gly
Shortening {Pyr}-PRRKLCILHRNPGRCYDKIPAFYYNQKKKQCERFDWSGCGGNSNRFKTIEECRRTCIG
Formula C305H478N98O84S6
Molar Mass 7072.00
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Bekkers J M, et al. Modulation of excitability by α-dendrotoxin-sensitive potassium channels in neocortical pyramidal neurons[J]. Journal of Neuroscience, 2001, 21(17): 6553-6560.