| Bioactivity | α-Dendrotoxin (α-DTX) is a small molecule peptide neurotoxin isolated from the venom of the African green mamba snake (Dendroaspis angusticeps). α-Dendrotoxin is also a KV1.1, KV1.2, KV1.6 and ASIC channel blocker. α-Dendrotoxin blocks potassium channels, lowers the threshold of neuronal action potentials, and increases the frequency of action potentials, thereby enhancing neuronal excitability. α-Dendrotoxin can be used in neurotoxicology research[1]. |
| CAS | 74504-53-3 |
| Sequence | {Pyr}-Pro-Arg-Arg-Lys-Leu-Cys-Ile-Leu-His-Arg-Asn-Pro-Gly-Arg-Cys-Tyr-Asp-Lys-Ile-Pro-Ala-Phe-Tyr-Tyr-Asn-Gln-Lys-Lys-Lys-Gln-Cys-Glu-Arg-Phe-Asp-Trp-Ser-Gly-Cys-Gly-Gly-Asn-Ser-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Ile-Gly |
| Shortening | {Pyr}-PRRKLCILHRNPGRCYDKIPAFYYNQKKKQCERFDWSGCGGNSNRFKTIEECRRTCIG |
| Formula | C305H478N98O84S6 |
| Molar Mass | 7072.00 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Bekkers J M, et al. Modulation of excitability by α-dendrotoxin-sensitive potassium channels in neocortical pyramidal neurons[J]. Journal of Neuroscience, 2001, 21(17): 6553-6560. |
α-Dendrotoxin
CAS: 74504-53-3 F: C305H478N98O84S6 W: 7072.00
α-Dendrotoxin (α-DTX) is a small molecule peptide neurotoxin isolated from the venom of the African green mamba snake
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.