| Bioactivity | α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM[1][2]. | ||||||
| Invitro | α-Bungarotoxin binds specifically and with high affinity to the nicotinic acetylcholine receptor and competes with binding of the natural ligand. α-Bungarotoxin (α-BTX), is a potent competitive inhibitors of nicotinic acetylcholine receptor function and is highly toxic due to functional blockade of AcChoRs at the neuromuscular junction[3]. | ||||||
| Name | α-Bungarotoxin | ||||||
| CAS | 11032-79-4 | ||||||
| Sequence | Ile-Val-Cys-His-Thr-Thr-Ala-Thr-Ser-Pro-Ile-Ser-Ala-Val-Thr-Cys-Pro-Pro-Gly-Glu-Asn-Leu-Cys-Tyr-Arg-Lys-Met-Trp-Cys-Asp-Ala-Phe-Cys-Ser-Ser-Arg-Gly-Lys-Val-Val-Glu-Leu-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ser-Lys-Lys-Pro-Tyr-Glu-Glu-Val-Thr-Cys-Cys-Ser-Thr-Asp-Lys-Cys-Asn-Pro-His-Pro-Lys-Gln-Arg-Pro-Gly (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65) | ||||||
| Shortening | IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65) | ||||||
| Formula | C338H529N97O105S11 | ||||||
| Molar Mass | 7984.12 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
α-Bungarotoxin
CAS: 11032-79-4 F: C338H529N97O105S11 W: 7984.12
α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.