| Bioactivity | wt hMLN is a microprotein that inhibits of SR Ca2+ pump (SERCA). wt hMLN plays an important role in skeletal muscle calcium homeostasis[1]. |
| Target | SERCA |
| Name | wt hMLN |
| Sequence | Met-Thr-Gly-Lys-Asn-Trp-Ile-Leu-Ile-Ser-Thr-Thr-Thr-Pro-Lys-Ser-Leu-Glu-Asp-Glu-Ile-Val-Gly-Arg-Leu-Leu-Lys-Ile-Leu-Phe-Val-Ile-Phe-Val-Asp-Leu-Ile-Ser-Ile-Ile-Tyr-Val-Val-Ile-Thr-Ser |
| Shortening | MTGKNWILISTTTPKSLEDEIVGRLLKILFVIFVDLISIIYVVITS |
| Formula | C245H404N54O66S |
| Molar Mass | 5194.22 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Alexis Boulinguiez, et al. NR1D1 controls skeletal muscle calcium homeostasis through myoregulin repression. JCI Insight. 2022 Sep 8; 7(17): e153584. |