| Bioactivity | pTH (2-38) (human) is involved in the anabolic action of bone. PTH (2-38) can increase the level of serum INS-PTH (complete N-terminal specific PTH)[1]. |
| Name | pTH (2-38) (human) |
| CAS | 154765-04-5 |
| Sequence | Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly |
| Shortening | VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG |
| Formula | C194H314N58O53S2 |
| Molar Mass | 4371.06 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
pTH (2-38) (human)
CAS: 154765-04-5 F: C194H314N58O53S2 W: 4371.06
pTH (2-38) (human) is involved in the anabolic action of bone. PTH (2-38) can increase the level of serum INS-PTH (compl
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.