| Bioactivity | pTH (2-34) (human) (80 μg/kg) slightly increases serum osteocalcin levels and alkaline phosphatase activity of bone extract (markers of bone formation) in mice. pTH (2-34) is not as effective as pTH (1-34)[1]. |
| Name | pTH (2-34) (human) |
| CAS | 247902-18-7 |
| Sequence | Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe |
| Shortening | VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
| Formula | C178H286N54O49S2 |
| Molar Mass | 4030.64 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
pTH (2-34) (human)
CAS: 247902-18-7 F: C178H286N54O49S2 W: 4030.64
pTH (2-34) (human) (80 μg/kg) slightly increases serum osteocalcin levels and alkaline phosphatase activity of bone ext
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.