pTH (1-37) (human)_product_DataBase

Bioactivity	pTH (1-37) (human) is a fragment of parathyroid hormone (PTH). pTH (1-37) (human) induces the cAMP formation and increases alkaline phosphatase activity. pTH (1-37) (human) increases growth, bone calcium content, and bone mineral density (BMD) in uremic animals. pTH (1-37) (human) has the potential for the research of osteoporosis[1][2][3].
Name	pTH (1-37) (human)
CAS	136799-54-7
Sequence	Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu
Shortening	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL
Formula	C195H316N58O54S2
Molar Mass	4401.08
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Reference	[1]. Tsai JA, et al. Parathyroid hormone-related protein (1-37) induces cAMP response in human osteoblast-like cells. Calcif Tissue Int. 1998 Mar;62(3):250-4. [2]. Schmitt CP, et al. Intermittent administration of parathyroid hormone (1-37) improves growth and bone mineral density in uremic rats. Kidney Int. 2000 Apr;57(4):1484-92. [3]. Stephan S, et al. Intermittent administration of the circulating form of human parathyroid hormone (hPTH-1-37) prevents bone loss in ovariectomized rats. Eur J Med Res. 2007 Jan 31;12(1):13-20.

PeptideDB