| Bioactivity | pH-Low Insertion Peptide (pHLIP) used as a specific ligand to target the tumor acidic microenvironment for tumors at early and metastatic stages[1]. |
| Name | pH-Low Insertion Peptide |
| CAS | 2293160-09-3 |
| Sequence | Ala-Cys-Glu-Gln-Asn-Pro-Ile-Tyr-Trp-Ala-Arg-Tyr-Ala-Asp-Trp-Leu-Phe-Thr-Thr-Pro-Leu-Leu-Leu-Leu-Asp-Leu-Ala-Leu-Leu-Val-Asp-Ala-Asp-Glu-Thr |
| Shortening | ACEQNPIYWARYADWLFTTPLLLLDLALLVDADET |
| Formula | C189H28N4O55S |
| Molar Mass | 4052.03 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
pH-Low Insertion Peptide
CAS: 2293160-09-3 F: C189H28N4O55S W: 4052.03
pH-Low Insertion Peptide (pHLIP) used as a specific ligand to target the tumor acidic microenvironment for tumors at ear
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.