PeptideDB

pH-Low Insertion Peptide TFA

CAS: F: C189H282N42O55S.xC2HF3O2 W: 4054.57 (free base)

pH-Low Insertion Peptide TFA is a specific ligand that targets the acidic tumor microenvironment of early- and metastati
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity pH-Low Insertion Peptide TFA is a specific ligand that targets the acidic tumor microenvironment of early- and metastatic-stage tumors[1].
Sequence Ala-Cys-Glu-Gln-Asn-Pro-Ile-Tyr-Trp-Ala-Arg-Tyr-Ala-Asp-Trp-Leu-Phe-Thr-Thr-Pro-Leu-Leu-Leu-Leu-Asp-Leu-Ala-Leu-Leu-Val-Asp-Ala-Asp-Glu-Thr
Shortening ACEQNPIYWARYADWLFTTPLLLLDLALLVDADET
Formula C189H282N42O55S.xC2HF3O2
Molar Mass 4054.57 (free base)
Appearance 固体
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Reference [1]. Yushuang Wei, et al. pH-responsive pHLIP (pH low insertion peptide) nanoclusters of superparamagnetic iron oxide nanoparticles as a tumor-selective MRI contrast agent. Acta Biomater. 2017 Jun;55:194-203.