| Bioactivity | pH-Low Insertion Peptide TFA is a specific ligand that targets the acidic tumor microenvironment of early- and metastatic-stage tumors[1]. | ||||||
| Sequence | Ala-Cys-Glu-Gln-Asn-Pro-Ile-Tyr-Trp-Ala-Arg-Tyr-Ala-Asp-Trp-Leu-Phe-Thr-Thr-Pro-Leu-Leu-Leu-Leu-Asp-Leu-Ala-Leu-Leu-Val-Asp-Ala-Asp-Glu-Thr | ||||||
| Shortening | ACEQNPIYWARYADWLFTTPLLLLDLALLVDADET | ||||||
| Formula | C189H282N42O55S.xC2HF3O2 | ||||||
| Molar Mass | 4054.57 (free base) | ||||||
| Appearance | 固体 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |
||||||
| Reference | [1]. Yushuang Wei, et al. pH-responsive pHLIP (pH low insertion peptide) nanoclusters of superparamagnetic iron oxide nanoparticles as a tumor-selective MRI contrast agent. Acta Biomater. 2017 Jun;55:194-203. |
pH-Low Insertion Peptide TFA
CAS: F: C189H282N42O55S.xC2HF3O2 W: 4054.57 (free base)
pH-Low Insertion Peptide TFA is a specific ligand that targets the acidic tumor microenvironment of early- and metastati
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.