| Bioactivity | mC46 (C46) peptide is a membrane-associated fusion peptide inhibitor. mC46 peptide potently inhibits HIV-1 replication and entry. mC46 also inhibits CCR5-tropic, CXCR4-tropic, and dual-tropic HIVs, SIV, and SHIV[1]. |
| Sequence | Trp-Met-Glu-Trp-Asp-Arg-Glu-Ile-Asn-Asn-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Glu-Leu-Asp-Lys-Trp-Ala-Ser-Leu-Trp-Asn-Trp-Phe |
| Shortening | WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF |
| Formula | C263H381N67O82S |
| Molar Mass | 5825.30 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Delviks-Frankenberry KA, et al. Potent dual block to HIV-1 infection using lentiviral vectors expressing fusion inhibitor peptide mC46- and Vif-resistant APOBEC3G. Mol Ther Nucleic Acids. 2023 Aug 11;33:794-809. |