| Bioactivity | Gp96-II is a gp96-blocking peptide that antagonizes gp96-mediated LPS-induced cytokine production. Gp96-II can be utilized in research on metabolic disease[1]. |
| Sequence | Leu-Asn-Val-Ser-Arg-Glu-Thr-Leu-Gln-Gln-His-Lys-Leu-Leu-Lys-Val-Ile-Arg-Lys-Lys-Leu-Val-Arg-Lys-Thr-Leu-Asp-Met-Ile-Lys-Lys-Ile-Ala-Asp-Asp-Lys-Tyr |
| Shortening | LNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY |
| Formula | C200H353N59O53S |
| Molar Mass | 4464.37 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Nold-Petry CA, et al. Gp96 Peptide Antagonist gp96-II Confers Therapeutic Effects in Murine Intestinal Inflammation. Front Immunol. 2017 Dec 11;8:1531. |