| Bioactivity | alpha-Cobratoxin is a neurotoxin, which can be isolated from the venom of the Thailand cobra. alpha-Cobratoxin exhibits neuromodulatory, antiviral, and analgesic activity. alpha-Cobratoxin also shows potent immunosuppressive activity for acute and chronic multiple sclerosis. alpha-Cobratoxin is further on research in adrenomyeloneuropathy[1]. |
| Name | alpha-Cobratoxin |
| CAS | 769933-79-1 |
| Sequence | Ile-Arg-Cys-Phe-Ile-Thr-Pro-Asp-Ile-Thr-Ser-Lys-Asp-Cys-Pro-Asn-Gly-His-Val-Cys-Tyr-Thr-Lys-Thr-Trp-Cys-Asp-Ala-Phe-Cys-Ser-Ile-Arg-Gly-Lys-Arg-Val-Asp-Leu-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Thr-Val-Lys-Thr-Gly-Val-Asp-Ile-Gln-Cys-Cys-Ser-Thr-Asp-Asn-Cys-Asn-Pro-Phe-Pro-Thr-Arg-Lys-Arg-Pro (Disulfide bonds:Cys3-Cys20, Cys14-Cys41, Cys26-Cys30, Cys45-Cys56, Cys57-Cys62) |
| Shortening | IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP (Disulfide bonds:Cys3-Cys20, Cys14-Cys41, Cys26-Cys30, Cys45-Cys56, Cys57-Cys62) |
| Formula | C332H520N98O101S10 |
| Molar Mass | 7820.93 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Reid PF. Alpha-cobratoxin as a possible therapy for multiple sclerosis: a review of the literature leading to its development for this application. Crit Rev Immunol. 2007;27(4):291-302. |