| Bioactivity | Wasabi Receptor Toxin (WaTx) active TRPA1 by prolonged channel openings and decreased Ca2+ permeability. Wasabi Receptor Toxin can be used in the research of acute and persistent pain[1]. |
| Name | Wasabi Receptor Toxin |
| CAS | 2569291-86-5 |
| Sequence | Ala-Ser-Pro-Gln-Gln-Ala-Lys-Tyr-Cys-Tyr-Glu-Gln-Cys-Asn-Val-Asn-Lys-Val-Pro-Phe-Asp-Gln-Cys-Tyr-Gln-Met-Cys-Ser-Pro-Leu-Glu-Arg-Ser (Disulfide bridge: Cys9-Cys27; Cys13-Cys23) |
| Shortening | ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS (Disulfide bridge: Cys9-Cys27; Cys13-Cys23) |
| Formula | C164H245N45O53S5 |
| Molar Mass | 3855.29 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. John V Lin King, et al. A Cell-Penetrating Scorpion Toxin Enables Mode-Specific Modulation of TRPA1 and Pain. Cell. 2019, 178,6. |