PeptideDB

Wasabi Receptor Toxin

CAS: 2569291-86-5 F: C164H245N45O53S5 W: 3855.29

Wasabi Receptor Toxin (WaTx) active TRPA1 by prolonged channel openings and decreased Ca2+ permeability. Wasabi Receptor
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Wasabi Receptor Toxin (WaTx) active TRPA1 by prolonged channel openings and decreased Ca2+ permeability. Wasabi Receptor Toxin can be used in the research of acute and persistent pain[1].
Name Wasabi Receptor Toxin
CAS 2569291-86-5
Sequence Ala-Ser-Pro-Gln-Gln-Ala-Lys-Tyr-Cys-Tyr-Glu-Gln-Cys-Asn-Val-Asn-Lys-Val-Pro-Phe-Asp-Gln-Cys-Tyr-Gln-Met-Cys-Ser-Pro-Leu-Glu-Arg-Ser (Disulfide bridge: Cys9-Cys27; Cys13-Cys23)
Shortening ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS (Disulfide bridge: Cys9-Cys27; Cys13-Cys23)
Formula C164H245N45O53S5
Molar Mass 3855.29
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. John V Lin King, et al. A Cell-Penetrating Scorpion Toxin Enables Mode-Specific Modulation of TRPA1 and Pain. Cell. 2019, 178,6.