| Bioactivity | Vm24-toxin is a toxin peptide that can be isolated from the Mexican scorpion Vaejovis mexicanus smithy. Vm24-toxin is an inhibitor of Kv1.3 potassium channel[1]. |
| Name | Vm24-toxin |
| CAS | 1373890-79-9 |
| Sequence | Ala-Ala-Ala-Ile-Ser-Cys-Val-Gly-Ser-Pro-Glu-Cys-Pro-Pro-Lys-Cys-Arg-Ala-Gln-Gly-Cys-Lys-Asn-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-Lys-Cys-Tyr-Tyr-Cys-NH2 (Disulfide bridge: Cys6-Cys26, Cys12-Cys31, Cys16-Cys33, Cys21-Cys36) |
| Shortening | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC-NH2 (Disulfide bridge: Cys6-Cys26, Cys12-Cys31, Cys16-Cys33, Cys21-Cys36) |
| Formula | C157H253N51O45S9 |
| Molar Mass | 3863.59 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Georgina B Gurrola, et al. Structure, function, and chemical synthesis of Vaejovis mexicanus peptide 24: a novel potent blocker of Kv1.3 potassium channels of human T lymphocytes. Biochemistry. 2012, 51, 19. |
Vm24-toxin
CAS: 1373890-79-9 F: C157H253N51O45S9 W: 3863.59
Vm24-toxin is a toxin peptide that can be isolated from the Mexican scorpion Vaejovis mexicanus smithy. Vm24-toxin is an
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.