PeptideDB

VSTx-3

CAS: F: C182H261N51O51S6 W: 4171.72

VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especial
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especially, a potent blocker of NaV1.8 channels (IC50 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7 and 0.77 μM for hNaV1.8 channels).
Name VSTx-3
Sequence Asp-Cys-Leu-Gly-Trp-Phe-Lys-Gly-Cys-Asp-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Glu-Gly-Tyr-Lys-Cys-Asn-Arg-Arg-Asp-Lys-Trp-Cys-Lys-Tyr-Lys-Leu-Trp (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
Shortening DCLGWFKGCDPDNDKCCEGYKCNRRDKWCKYKLW (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
Formula C182H261N51O51S6
Molar Mass 4171.72
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Ronit S Cherki, et al. Two tarantula venom peptides as potent and differential Na(V) channels blockers. Toxicon. 2014, 58.