| Bioactivity | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain[1]. |
| Target | α2δ-1 |
| Name | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW |
| CAS | 2279952-25-7 |
| Shortening | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW |
| Formula | C171H250N40O39 |
| Molar Mass | 3490.06 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Chen Y, et al. Increased α2δ-1-NMDA receptor coupling potentiates glutamatergic input to spinal dorsal horn neurons in chemotherapy-induced neuropathic pain. J Neurochem. |
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
CAS: 2279952-25-7 F: C171H250N40O39 W: 3490.06
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1T
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.