| Bioactivity | VIPhyb (compound VIPhyb) is a vasoactive intestinal polypeptide (VIP) receptor antagonist that can be used in the study of cancers such as non-small cell lung cancer (NSCLC)[1]. |
| Name | VIPhyb |
| CAS | 125093-93-8 |
| Sequence | Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 |
| Shortening | KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Formula | C154H257N49O40S |
| Molar Mass | 3467.06 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Moody TW, et al. (Stearyl, Norleucine17)VIP hybrid antagonizes VIP receptors on non-small cell lung cancer cells. Life Sci. 1997;61(17):1657-66. |
VIPhyb
CAS: 125093-93-8 F: C154H257N49O40S W: 3467.06
VIPhyb (compound VIPhyb) is a vasoactive intestinal polypeptide (VIP) receptor antagonist that can be used in the study
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.