| Bioactivity | VIP Guinea pig TFA (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function[1][2]. |
| Invitro | Vasoactive intestinal peptide (10(-7)M) shortened S phase and G1 phase of neuroepithelial cells by 50% (4.8-2.4 h) and 58% (1.9-0.8 h), respectively, compared with controls[1]. |
| Name | VIP(Guinea pig) TFA |
| Sequence | His-Ser-Asp-Ala-Leu-Phe-Thr-Asp-Thr-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Met-Lys-Lys-Tyr-Leu-Asn-Ser-Val-Leu-Asn-NH2 |
| Shortening | HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2 |
| Formula | C147H239N43O42S2.C2HF3O2 |
| Molar Mass | 3458.88 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
VIP(Guinea pig) TFA
CAS: F: C147H239N43O42S2.C2HF3O2 W: 3458.88
VIP Guinea pig TFA (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.