| Bioactivity | Urodilatin is an analogue of ANF-(99-126). Urodilatin is a diuretic-natriuretic regulatory peptide. Urodilatin can be used for research of acute renal failure, congestive heart failure, and bronchial asthma, etc[1]. |
| Name | Urodilatin |
| CAS | 115966-23-9 |
| Sequence | Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr |
| Shortening | TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY |
| Formula | C145H236N52O44S3 |
| Molar Mass | 3507.94 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Forssmann W, et al. The renal urodilatin system: clinical implications. Cardiovasc Res. 2001 Aug 15;51(3):450-62. |
Urodilatin
CAS: 115966-23-9 F: C145H236N52O44S3 W: 3507.94
Urodilatin is an analogue of ANF-(99-126). Urodilatin is a diuretic-natriuretic regulatory peptide. Urodilatin can be us
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.