| Bioactivity | Urocortin III (mouse) (free acid) is a selective CRF2 receptor agonist (with high affinity for the CRF2 receptor). Urocortin III (mouse) (free acid) significantly inhibits gastric emptying without modifying colonic transit[1][2]. |
| Name | Urocortin III (mouse) (free acid) |
| Shortening | FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI |
| Formula | C186H311N51S2 |
| Molar Mass | 4171.26 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Urocortin III (mouse) (free acid)
CAS: F: C186H311N51S2 W: 4171.26
Urocortin III (mouse) (free acid) is a selective CRF2 receptor agonist (with high affinity for the CRF2 receptor). Uroco
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.