| Bioactivity | Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2[1]. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics[2]. | ||||||
| Name | Urocortin III, mouse TFA | ||||||
| Sequence | Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2 | ||||||
| Shortening | FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 | ||||||
| Formula | C188H313N52F3O54S2 | ||||||
| Molar Mass | 4286.99 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
Urocortin III, mouse TFA
CAS: F: C188H313N52F3O54S2 W: 4286.99
Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds a
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.