PeptideDB

Ularitide

CAS: 118812-69-4 F: C145H234N52O44S3 W: 3505.96

Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ulariti
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ularitide also regulates renal dopamine metabolism Ularitide can be used in the research of heart failure[1][2][4][5].
Invitro Ularitide increases the amount of cyclic nucleotides and decreases the raise in permeability in HUVEC cells[2].Ularitide (1 nM-1 μM, 15 min) reverses methacholine-evoked contraction in bovine bronchi[3].Ularitide (1 μM, 0-300 s) increases cyclic GMP levels in the presence of phosphoramidon in bovine bronchi[3].
Name Ularitide
CAS 118812-69-4
Sequence Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys11-Cys27)
Shortening TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge:Cys11-Cys27)
Formula C145H234N52O44S3
Molar Mass 3505.96
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.