| Bioactivity | Termicin is an antimicrobial peptide from Pseudacanthotermes spiniger. Termicin has anti-gram-positive bacteria, filamentous fungi and yeast activity[1]. |
| Name | Termicin |
| Sequence | Ala-Cys-Asn-Phe-Gln-Ser-Cys-Trp-Ala-Thr-Cys-Gln-Ala-Gln-His-Ser-Ile-Tyr-Phe-Arg-Arg-Ala-Phe-Cys-Asp-Arg-Ser-Gln-Cys-Lys-Cys-Val-Phe-Val-Arg-Gly-NH2 (Disulfide bridge:C1-C4,C2-C5,C3-C6) |
| Shortening | ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG-NH2 (Disulfide bridge:C1-C4,C2-C5,C3-C6) |
| Formula | C181H266N58O48S6 |
| Molar Mass | 4214.80 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Lamberty M, et al Constitutive expression of a cysteine-rich antifungal and a linear antibacterial peptide in a termite insect. J Biol Chem. 2001 Feb 9;276(6):4085-92. |