| Bioactivity | Teduglutide is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide is associated with trophic effects on gut mucosa. Teduglutide can be used for the research of short bowel syndrome (SBS) and Crohn's disease (CD)[1][2]. | ||||||
| Name | Teduglutide | ||||||
| CAS | 197922-42-2 | ||||||
| Shortening | HGDGSFSDEMNTILDNLAARDFINWLIQTKITD | ||||||
| Formula | C164H252N44O55S | ||||||
| Molar Mass | 3752.13 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
Teduglutide
CAS: 197922-42-2 F: C164H252N44O55S W: 3752.13
Teduglutide is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide is associated w
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.