| Bioactivity | Teduglutide TFA is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide TFA is associated with trophic effects on gut mucosa. Teduglutide TFA can be used for the research of short bowel syndrome (SBS) and Crohn's disease (CD)[1][2]. |
| Name | Teduglutide TFA |
| Shortening | HGDGSFSDEMNTILDNLAARDFINWLIQTKITD |
| Formula | C166H253F3N44O57S |
| Molar Mass | 3866.15 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Teduglutide TFA
CAS: F: C166H253F3N44O57S W: 3866.15
Teduglutide TFA is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide TFA is asso
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.