| Bioactivity | Tau Peptide (337-368) (Repeat 4 Domain), is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of drug research and development[1]. |
| Name | Tau Peptide (337-368) (Repeat 4 Domain) |
| CAS | 330456-27-4 |
| Sequence | Val-Glu-Val-Lys-Ser-Glu-Lys-Leu-Asp-Phe-Lys-Asp-Arg-Val-Gln-Ser-Lys-Ile-Gly-Ser-Leu-Asp-Asn-Ile-Thr-His-Val-Pro-Gly-Gly-Gly-Asn |
| Shortening | VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN |
| Formula | C150H248N44O50 |
| Molar Mass | 3467.84 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54. |
Tau Peptide (337-368) (Repeat 4 Domain)
CAS: 330456-27-4 F: C150H248N44O50 W: 3467.84
Tau Peptide (337-368) (Repeat 4 Domain), is a polypeptide that can be found by peptide screening. Peptide screening is a
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.