| Bioactivity | Tat-beclin 1 scrambled is the scrambled part and a scrambled control of Tat-beclin 1 (HY-P2260), which is derived from a region of the autophagy protein, beclin 1. beclin 1 induces autophagy via binding human immunodeficiency virus, HIV-1 Nef and interacting with negative regulator GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens, such as HIV-1. Tat-beclin 1 also reduces mortality in mice infected with chikungunya or West Nile virus[1]. |
| Name | Tat-beclin 1 scrambled |
| Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Val-Gly-Asn-Asp-Phe-Phe-Ile-Asn-His-Glu-Thr-Thr-Gly-Phe-Ala-Thr-Glu-Trp |
| Shortening | YGRKKRRQRRRGGVGNDFFINHETTGFATEW |
| Formula | C164H251N57O45 |
| Molar Mass | 3741.10 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Shoji-Kawata S, et al. Identification of a candidate therapeutic autophagy-inducing peptide. Nature. 2013 Feb 14;494(7436):201-6. |
Tat-beclin 1 scrambled
CAS: F: C164H251N57O45 W: 3741.10
Tat-beclin 1 scrambled is the scrambled part and a scrambled control of Tat-beclin 1 (HY-P2260), which is derived from a
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.